Research peptide · Lyophilized
IGF-1 LR3
A synthetic version of human insulin-like growth factor 1 (IGF-1) with 83 amino acids: an extra 13 at the start of the chain (Long) and an arginine swapped in at position 3 (R3).
No reviews yet
Illustrative packaging · see batch records for product details
About IGF-1 LR3
A synthetic version of human insulin-like growth factor 1 (IGF-1) with 83 amino acids: an extra 13 at the start of the chain (Long) and an arginine swapped in at position 3 (R3).
Research context
Studied in cell-growth signaling and in comparisons of IGF receptor binding with binding-protein interactions. The LR3 modifications change how the peptide interacts with IGF-binding proteins in laboratory experiments.
IGF analogue and binding-protein studyFor laboratory research only. Research context does not establish safety or effectiveness for use in people or animals.
Explore the IGF-1 LR3 reference entryChemistry
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- CAS number
- 946870-92-4
- Formula
- C400H625N111O115S9
- Molecular weight
- 9,117.6 g/mol
Storage and handling
Freeze-dried (lyophilized) powder. Keep the vial sealed in a freezer at -20 °C for long-term storage; a fridge at 2 to 8 °C is fine for short periods. Keep it out of light and away from moisture. Shelf life is 24 months from the lot release date when stored this way.
$65 1 mg $65.00 / mg
1 mg · Certificate of analysis
No current COA is published for this size. A report for another size or batch does not apply to this vial.
New to COAs? How to read a reportLeave your email and we'll send one message when 1 mg is available to order.
One email when this size is available to order, nothing else. Cancel any time by emailing us. Privacy.
Batch reports
All lab resultsA lot identifies one batch. Read its laboratory report and review status below. An attached report does not mean a batch has been released for sale. A batch without a lab report is marked as such.
No current batch report is published for this compound. Earlier records remain below when available.
Reviews
0No published reviews for IGF-1 LR3 yet.
We email a review link a few days after delivery. Every genuine review we receive is published, good or bad.